PYY-(3-36)
SMILES | None |
InChIKey | None |
Sequence | AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Physiological/Surrogate | Endogenous |
Approved drug | No |
Database connections
Sankey plot
Compound is not listed as a drug.
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
Y5 | NPY5R | Human | Neuropeptide Y | A | pKi | 8.0 | 8.0 | 8.0 | Guide to Pharmacology |
Y4 | NPY4R | Rat | Neuropeptide Y | A | pKi | 6.2 | 6.2 | 6.2 | Guide to Pharmacology |
Y5 | NPY5R | Rat | Neuropeptide Y | A | pKi | 8.4 | 8.4 | 8.4 | Guide to Pharmacology |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |