urocortin 3


SMILES None
InChIKey None
Sequence FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Physiological/Surrogate Endogenous
Approved drug No

Database connections

Sankey plot

Compound is not listed as a drug.

Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
CRF2 CRFR2 Human Corticotropin-releasing factor B1 pKd 7.9 7.95 8.0 Guide to Pharmacology
CRF2 CRFR2 Rat Corticotropin-releasing factor B1 pKd 7.7 7.7 7.7 Guide to Pharmacology
CRF2 CRFR2 Mouse Corticotropin-releasing factor B1 pKd 7.9 7.9 7.9 Guide to Pharmacology
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database