urotensin 1 (fish)


SMILES None
InChIKey None
Sequence NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Physiological/Surrogate Surrogate
Approved drug No

Database connections


Sankey plot

Compound is not listed as a drug.


Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
CRF1 CRFR1 Human Corticotropin-releasing factor B1 pKd 7.8 8.6 9.4 Guide to Pharmacology
CRF2 CRFR2 Human Corticotropin-releasing factor B1 pKd 7.3 8.1 8.9 Guide to Pharmacology
CRF2 CRFR2 Mouse Corticotropin-releasing factor B1 pKd 8.5 8.5 8.5 Guide to Pharmacology
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database