agouti-related protein
SMILES | None |
InChIKey | None |
Sequence | AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Physiological/Surrogate | Endogenous |
Approved drug | No |
Database connections
Ligand site mutations | MC4 |
Sankey plot
Compound is not listed as a drug.
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
MC3 | MC3R | Human | Melanocortin | A | pIC50 | 7.7 | 7.7 | 7.7 | Guide to Pharmacology |
MC4 | MC4R | Human | Melanocortin | A | pIC50 | 9.3 | 9.3 | 9.3 | Guide to Pharmacology |
MC5 | MC5R | Human | Melanocortin | A | pIC50 | 6.5 | 6.5 | 6.5 | Guide to Pharmacology |