C5a des-Arg


SMILES None
InChIKey None
Sequence TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLG

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Physiological/Surrogate Endogenous
Approved drug No

Database connections

Structure pdb 8JZZ

Sankey plot

Compound is not listed as a drug.

Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
C5a2 C5AR2 Human Complement peptide A pEC50 8.64 8.64 8.64 Guide to Pharmacology
C5a2 C5AR2 Human Complement peptide A pIC50 7.4 7.65 7.9 Guide to Pharmacology
C5a1 C5AR1 Human Complement peptide A pIC50 6.2 6.3 6.4 Guide to Pharmacology