chemerin


SMILES None
InChIKey None
Sequence ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQF

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Physiological/Surrogate Endogenous
Approved drug No

Database connections

Sankey plot

Compound is not listed as a drug.

Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
chemerin CML1 Human Chemerin receptor A pKd 8.31 8.31 8.31 Guide to Pharmacology
chemerin 2 CML2 Human Chemerin receptor A pKd 8.28 8.28 8.28 Guide to Pharmacology
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
chemerin CML1 Human Chemerin receptor A pEC50 7.6 8.04 8.52 Guide to Pharmacology
chemerin 2 CML2 Human Chemerin receptor A pEC50 8.8 9.2 9.6 Guide to Pharmacology