corticotrophin-releasing hormone


SMILES None
InChIKey None
Sequence SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Physiological/Surrogate Endogenous
Approved drug No

Database connections

Ligand site mutations CRF1

Sankey plot

Compound is not listed as a drug.


Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
CRF1 CRFR1 Human Corticotropin-releasing factor B1 pKd 7.1 8.05 9.0 Guide to Pharmacology
CRF2 CRFR2 Human Corticotropin-releasing factor B1 pKd 6.5 6.95 7.4 Guide to Pharmacology
CRF2 CRFR2 Mouse Corticotropin-releasing factor B1 pKi 7.8 7.8 7.8 Guide to Pharmacology
CRF2 CRFR2 Rat Corticotropin-releasing factor B1 pKd 7.9 7.9 7.9 Guide to Pharmacology
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database