corticotropin-releasing factor
SMILES | None |
InChIKey | None |
Sequence | SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Physiological/Surrogate | Surrogate |
Approved drug | No |
Database connections
Sankey plot
Compound is not listed as a drug.
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
CRF1 | CRFR1 | Human | Corticotropin-releasing factor | B1 | pKd | 7.2 | 8.05 | 8.9 | Guide to Pharmacology |
CRF2 | CRFR2 | Human | Corticotropin-releasing factor | B1 | pKd | 5.9 | 6.4 | 6.9 | Guide to Pharmacology |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |