galanin-like peptide


SMILES None
InChIKey None
Sequence APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Physiological/Surrogate Endogenous
Approved drug No

Database connections


Sankey plot

Compound is not listed as a drug.


Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
GAL1 GALR1 Human Galanin A pIC50 7.11 7.11 7.11 Guide to Pharmacology
GAL2 GALR2 Human Galanin A pIC50 7.55 7.64 7.73 Guide to Pharmacology
GAL3 GALR3 Human Galanin A pIC50 8.0 8.0 8.0 Guide to Pharmacology