[His5]PTH-(1-34) (human)
SMILES | None |
InChIKey | None |
Sequence | SVSEHQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Physiological/Surrogate | Surrogate |
Approved drug | No |
Database connections
Sankey plot
Compound is not listed as a drug.
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
PTH1 | PTH1R | Human | Parathyroid hormone | B1 | pIC50 | 5.3 | 5.3 | 5.3 | Guide to Pharmacology |
PTH2 | PTH2R | Human | Parathyroid hormone | B1 | pIC50 | 6.6 | 6.6 | 6.6 | Guide to Pharmacology |
PTH1 | PTH1R | Rat | Parathyroid hormone | B1 | pIC50 | 5.1 | 5.1 | 5.1 | Guide to Pharmacology |