neuropeptide W-30
SMILES | None |
InChIKey | None |
Sequence | WYKHVASPRYHTVGRAAGLLMGLRRSPYLW |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Physiological/Surrogate | Endogenous |
Approved drug | No |
Database connections
Sankey plot
Compound is not listed as a drug.
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
NPBW1 | NPBW1 | Human | Neuropeptide W/neuropeptide B | A | pIC50 | 10.6 | 10.6 | 10.6 | Guide to Pharmacology |
NPBW2 | NPBW2 | Human | Neuropeptide W/neuropeptide B | A | pIC50 | 9.4 | 9.4 | 9.4 | Guide to Pharmacology |