pancreatic polypeptide


SMILES None
InChIKey None
Sequence APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Physiological/Surrogate Endogenous
Approved drug No

Database connections

Sankey plot

Compound is not listed as a drug.

Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
Y4 NPY4R Human Neuropeptide Y A pKi 8.7 9.8 10.9 Guide to Pharmacology
Y5 NPY5R Human Neuropeptide Y A pKi 8.0 8.0 8.0 Guide to Pharmacology
Y1 NPY1R Rat Neuropeptide Y A pKi 7.9 7.9 7.9 Guide to Pharmacology
Y4 NPY4R Rat Neuropeptide Y A pKi 10.5 10.7 10.9 Guide to Pharmacology
Y4 NPY4R Mouse Neuropeptide Y A pKi 10.6 10.6 10.6 Guide to Pharmacology
Y5 NPY5R Rat Neuropeptide Y A pKi 8.4 8.85 9.3 Guide to Pharmacology
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database