peptide YY
SMILES | None |
InChIKey | IXMRLEGHWROJAA-HDTKZREISA-N |
Sequence | YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Physiological/Surrogate | Endogenous |
Approved drug | No |
Database connections
Sankey plot
Compound is not listed as a drug.
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
Y5 | NPY5R | Human | Neuropeptide Y | A | pKi | 8.9 | 8.9 | 8.9 | Guide to Pharmacology |
Y4 | NPY4R | Rat | Neuropeptide Y | A | pKi | 6.3 | 6.85 | 8.5 | Guide to Pharmacology |
Y5 | NPY5R | Rat | Neuropeptide Y | A | pKi | 9.0 | 9.0 | 9.0 | Guide to Pharmacology |
Y2 | Q9ERC0 | Rat | Neuropeptide Y | A | pKi | 10.0 | 10.0 | 10.0 | Guide to Pharmacology |
Y1 | NPY1R | Rat | Neuropeptide Y | A | pKi | 10.2 | 10.2 | 10.2 | Guide to Pharmacology |
Y2 | NPY2R | Human | Neuropeptide Y | A | pKi | 9.5 | 9.5 | 9.5 | Guide to Pharmacology |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
Y4 | NPY4R | Mouse | Neuropeptide Y | A | pIC50 | 6.3 | 7.4 | 8.5 | Guide to Pharmacology |
Y2 | Q9ERC0 | Rat | Neuropeptide Y | A | pIC50 | 9.85 | 9.85 | 9.85 | ChEMBL |
Y2 | NPY2R | Human | Neuropeptide Y | A | pIC50 | 10.15 | 10.15 | 10.15 | ChEMBL |
Y1 | NPY1R | Human | Neuropeptide Y | A | pIC50 | 10.7 | 10.7 | 10.7 | ChEMBL |