peptide YY


SMILES None
InChIKey None
Sequence YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Physiological/Surrogate Endogenous
Approved drug No

Database connections

Sankey plot

Compound is not listed as a drug.

Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
Y2 NPY2R Human Neuropeptide Y A pKi 9.5 9.65 9.8 Guide to Pharmacology
Y4 NPY4R Human Neuropeptide Y A pKi 8.8 8.8 8.8 Guide to Pharmacology
Y4 NPY4R Rat Neuropeptide Y A pKi 6.4 6.4 6.4 Guide to Pharmacology
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
Y1 NPY1R Rat Neuropeptide Y A pIC50 7.6 8.05 8.5 Guide to Pharmacology