PG 99-465
| SMILES | None |
| InChIKey | None |
| Sequence | HSDAVFTDNYTKLRKQMAVKKYLNSIKKGGT |
Chemical properties
| Hydrogen bond acceptors | None |
| Hydrogen bond donors | None |
| Rotatable bonds | None |
| Molecular weight (Da) |
Drug properties
| Molecular type | Peptide |
| Physiological/Surrogate | Surrogate |
| Approved drug | No |
Database connections
Sankey plot
Compound is not listed as a drug.
Bioactivities
| Receptor | Activity | Source | |||||||
|---|---|---|---|---|---|---|---|---|---|
| GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
| Receptor | Activity | Source | |||||||
|---|---|---|---|---|---|---|---|---|---|
| GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
| PAC1 | PACR | Human | VIP and PACAP | B1 | pEC50 | 7.1 | 7.1 | 7.1 | Guide to Pharmacology |
| VPAC1 | VIPR1 | Human | VIP and PACAP | B1 | pIC50 | 6.7 | 6.7 | 6.7 | Guide to Pharmacology |
| VPAC1 | VIPR1 | Human | VIP and PACAP | B1 | pEC50 | 6.8 | 6.8 | 6.8 | Guide to Pharmacology |
| VPAC2 | VIPR2 | Human | VIP and PACAP | B1 | pIC50 | 8.149999999999999 | 8.15 | 8.15 | Guide to Pharmacology |
| VPAC2 | VIPR2 | Human | VIP and PACAP | B1 | pEC50 | 8.350000000000001 | 8.35 | 8.35 | Guide to Pharmacology |