cytokine domain of tyrosyl tRNA synthetase



cytokine domain of tyrosyl tRNA synthetase

No image available
SMILES None
InChIKey None
Sequence PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS

Chemical Properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Database connections



No bioactivity data available.

cytokine domain of tyrosyl tRNA synthetase

No image available

Drug properties

Molecular type Peptide
Physiological/Surrogate Endogenous
Approved drug No

Clinical Trials

Phase I 0
Phase II 0
Phase III 0
Approved No

Database connections



Compound is not listed as a drug.

This ligand is endogenous.