GPCRdb

ACTH

SMILES	None
InChIKey	IDLFZVILOHSSID-OVLDLUHVSA-N
Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

Chemical Properties

Hydrogen bond acceptors	None
Hydrogen bond donors	None
Rotatable bonds	None
Molecular weight (Da)

Database connections

Guide To Pharmacology DrugBank Drug Central ChEMBL_compound_ids PubChem GPCRdb
Structure pdb	8GY7
Ligand site mutations	CRF₁

No bioactivity data available.

ACTH

Drug properties

Molecular type	Peptide
Physiological/Surrogate	Endogenous
Approved drug	Yes

Distribution across phases (no. indications)

Phase I 3

Phase II 7

Phase III 2

Phase IV 9

Database connections

Guide To Pharmacology DrugBank Drug Central ChEMBL_compound_ids PubChem GPCRdb
Structure pdb	8GY7
Ligand site mutations	CRF₁

Sankey plot

Drug Information

Search:

Target					Disease

Gene	Protein	Receptor family	Ligand type	Class	Name	Phase	ICD11	ATC	Association score

ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Amyotrophic lateral sclerosis	3	8B60.0		0.083
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Anterior uveitis, unspecified	2	9A96.Z		0.388
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Dermatomyositis, unspecified	2	4A41.0Z		0.074
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Infantile spasms	4	8A62.0		0.388
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Migraine, unspecified	2	8A80.Z		0.074
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Multiple sclerosis, unspecified	4	8A40.Z		0.559
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Nephritic syndrome	1	GB40		0.231
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Nephrotic syndrome	3	GB41		0.493
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Optic neuritis, unspecified	1	9C40.1Z		0.018
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Other proliferative retinopathy	1	9B78.2		0.018
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Primary progressive multiple sclerosis	2	8A40.1		0.074
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Proteinuria, unspecified	2	MF96.Z		0.370
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Psoriatic arthritis, unspecified	4	FA21.Z		0.462
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Rheumatoid arthritis, serology unspecified	4	FA20.Z		0.550
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Sarcoidosis, unspecified	4	4B20.Z		0.529
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Scleritis	2	9B51		0.074
ACTHR	MC₂ receptor	Melanocortin receptors	Peptide receptors	A	Secondary progressive multiple sclerosis	2	8A40.2		0.074

Showing 1 to 17 of 17 entries

Join us

Cite us

Main reference

ACTH

ACTH

Chemical Properties

Database connections

No bioactivity data available.

ACTH

Drug properties

Distribution across phases (no. indications)

Database connections

Sankey plot

Drug Information